SCOPe 2.08: Domain d2evsa_: 2evs A:

Lineage for d2evsa_ (2evs A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)

6. Protein Glycolipid transfer protein, GLTP [110006] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
   Uniprot Q9NZD2

8. Domain d2evsa_: 2evs A: [132442]
   automated match to d1sx6a_
   complexed with d10, glc, hex

Details for d2evsa_

PDB Entry: 2evs, 2.2 Å

PDB Description: crystal structure of human glycolipid transfer protein complexed with n-hexyl-beta-d-glucoside

PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d2evsa_:

Sequence; same for both SEQRES and ATOM records:

>d2evsa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
aehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnp
akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli
rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlfl
vnytatidviyemytqmnaelnykv

Timeline for d2evsa_:

• d2evsa_ first appeared in SCOP 1.73, called d2evsa1
  
• d2evsa_ appears in SCOPe 2.07