Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
Family c.111.1.0: automated matches [191511] (1 protein) not a true family |
Protein automated matches [190855] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188203] (1 PDB entry) |
Domain d1zud3_: 1zud 3: [161377] Other proteins in same PDB: d1zud2_, d1zud4_ automated match to d1jw9b_ complexed with ca, na, zn |
PDB Entry: 1zud (more details), 1.98 Å
SCOPe Domain Sequences for d1zud3_:
Sequence, based on SEQRES records: (download)
>d1zud3_ c.111.1.0 (3:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc pvcgg
>d1zud3_ c.111.1.0 (3:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep tagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcgg
Timeline for d1zud3_: