Lineage for d1zud3_ (1zud 3:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011421Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 1011422Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 1011481Family c.111.1.0: automated matches [191511] (1 protein)
    not a true family
  6. 1011482Protein automated matches [190855] (2 species)
    not a true protein
  7. 1011483Species Escherichia coli K-12 [TaxId:83333] [188203] (1 PDB entry)
  8. 1011485Domain d1zud3_: 1zud 3: [161377]
    Other proteins in same PDB: d1zud2_, d1zud4_
    automated match to d1jw9b_
    complexed with ca, na, zn

Details for d1zud3_

PDB Entry: 1zud (more details), 1.98 Å

PDB Description: Structure of ThiS-ThiF protein complex
PDB Compounds: (3:) Adenylyltransferase thiF

SCOPe Domain Sequences for d1zud3_:

Sequence, based on SEQRES records: (download)

>d1zud3_ c.111.1.0 (3:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc
pvcgg

Sequence, based on observed residues (ATOM records): (download)

>d1zud3_ c.111.1.0 (3:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
tagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcgg

SCOPe Domain Coordinates for d1zud3_:

Click to download the PDB-style file with coordinates for d1zud3_.
(The format of our PDB-style files is described here.)

Timeline for d1zud3_: