SCOPe 2.08: Domain d1zud3_: 1zud 3:

Lineage for d1zud3_ (1zud 3:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest

4. Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families)
   transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
   the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds

5. Family c.111.1.0: automated matches [191511] (1 protein)
   not a true family

6. Protein automated matches [190855] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188203] (1 PDB entry)

8. Domain d1zud3_: 1zud 3: [161377]
   Other proteins in same PDB: d1zud2_, d1zud4_
   automated match to d1jw9b_
   complexed with ca, na, zn

Details for d1zud3_

PDB Entry: 1zud, 1.98 Å

PDB Description: Structure of ThiS-ThiF protein complex

PDB Compounds: (3:) Adenylyltransferase thiF

SCOPe Domain Sequences for d1zud3_:

Sequence, based on SEQRES records:

>d1zud3_ c.111.1.0 (3:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc
pvcgg

Sequence, based on observed residues (ATOM records):

>d1zud3_ c.111.1.0 (3:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
tagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcgg

Timeline for d1zud3_:

• d1zud3_ first appeared in SCOPe 2.01
  
• d1zud3_ appears in SCOPe 2.07