PDB entry 1zud

View 1zud on RCSB PDB site
Description: Structure of ThiS-ThiF protein complex
Class: transferase/biosynthetic protein
Keywords: Thiamin, Thiazole, protein-protein complex, THIS, THIF, TRANSFERASE-BIOSYNTHETIC PROTEIN COMPLEX
Deposited on 2005-05-30, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.174
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Adenylyltransferase thiF
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zud1_
  • Chain '2':
    Compound: this protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zud2_
  • Chain '3':
    Compound: Adenylyltransferase thiF
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zud3_
  • Chain '4':
    Compound: this protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zud4_
  • Heterogens: ZN, CA, NA, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1zud1 (1:)
    mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
    ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
    vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
    erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc
    pvcggsnadpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zud1 (1:)
    mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
    ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
    vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpagvvg
    pvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcgg
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1zud2 (2:)
    mqilfndqamqcaagqtvhelleqldqrqagaalainqqivpreqwaqhivqdgdqillf
    qviagg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zud2 (2:)
    qilfndqamqcaagqtvhelleqldqrqagaalainqqivpreqwaqhivqdgdqillfq
    viagg
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1zud3 (3:)
    mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
    ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
    vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
    erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc
    pvcggsnadpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zud3 (3:)
    mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
    ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
    vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
    tagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcgg
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zud4 (4:)
    mqilfndqamqcaagqtvhelleqldqrqagaalainqqivpreqwaqhivqdgdqillf
    qviagg