Lineage for d1jw9b_ (1jw9 B:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the restSuperfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) 
transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-foldsFamily c.111.1.1: Molybdenum cofactor biosynthesis protein MoeB [69573] (1 protein) Protein Molybdenum cofactor biosynthesis protein MoeB [69574] (1 species) Species Escherichia coli [TaxId:562] [69575] (3 PDB entries) 
Domain d1jw9b_: 1jw9 B: [67377]
Other proteins in same PDB: d1jw9d_
complexed with so4, zn
Details for d1jw9b_
PDB Entry: 1jw9 (more details), 1.7 Å
PDB Description: Structure of the Native MoeB-MoaD Protein Complex
PDB Compounds: (B:) molybdopterin biosynthesis moeb proteinSCOPe Domain Sequences for d1jw9b_:
Sequence, based on SEQRES records: (download)
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}
aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlfg
enaltcveagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmrn
pgcevcg
Sequence, based on observed residues (ATOM records): (download)
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]}
aelsdqemlrynrqiilrgfdfdgqealkdsrvlivglgglgcaasqylasagvgnltll
dfdtvslsnlqrqtlhsdatvgqpkvesardaltrinphiaitpvnallddaelaaliae
hdlvldctdnvavrnqlnagcfaakvplvsgaairmegqitvftyqdgepcyrclsrlfg
eagvmapligvigslqameaikmlagygkpasgkivmydamtcqfremklmrnpgcevcg
SCOPe Domain Coordinates for d1jw9b_:
Click to download the PDB-style file with coordinates for d1jw9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jw9b_:
- d1jw9b_ first appeared in SCOP 1.59
- d1jw9b_ appears in SCOPe 2.02
- d1jw9b_ appears in SCOPe 2.04
- d1jw9b_ appears in the current release, SCOPe 2.08
View in 3D
