Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
Protein F1 capsule antigen Caf1 [89213] (1 species) |
Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries) |
Domain d1z9sc_: 1z9s C: [161370] Other proteins in same PDB: d1z9sa1, d1z9sa2 automated match to d1p5ub_ |
PDB Entry: 1z9s (more details), 2.2 Å
SCOPe Domain Sequences for d1z9sc_:
Sequence, based on SEQRES records: (download)
>d1z9sc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]} itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd gnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagky tdavtvtvsnq
>d1z9sc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]} itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd gnnhqfttkvigkdsrdfdispkvngenldvvlatgsqdffvrsigskggklaagkytda vtvtvsnq
Timeline for d1z9sc_: