Lineage for d1z9sc_ (1z9s C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938566Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 938571Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 938572Protein F1 capsule antigen Caf1 [89213] (1 species)
  7. 938573Species Yersinia pestis [TaxId:632] [89214] (3 PDB entries)
  8. 938578Domain d1z9sc_: 1z9s C: [161370]
    Other proteins in same PDB: d1z9sa1, d1z9sa2
    automated match to d1p5ub_

Details for d1z9sc_

PDB Entry: 1z9s (more details), 2.2 Å

PDB Description: Crystal Structure of the native chaperone:subunit:subunit Caf1M:Caf1:Caf1 complex
PDB Compounds: (C:) F1 capsule antigen

SCOPe Domain Sequences for d1z9sc_:

Sequence, based on SEQRES records: (download)

>d1z9sc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagky
tdavtvtvsnq

Sequence, based on observed residues (ATOM records): (download)

>d1z9sc_ b.2.3.2 (C:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenldvvlatgsqdffvrsigskggklaagkytda
vtvtvsnq

SCOPe Domain Coordinates for d1z9sc_:

Click to download the PDB-style file with coordinates for d1z9sc_.
(The format of our PDB-style files is described here.)

Timeline for d1z9sc_: