Lineage for d1p5ub_ (1p5u B:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) 
Family b.2.3.2: Pilus subunits [49405] (9 proteins) 
Protein F1 capsule antigen Caf1 [89213] (1 species) Species Yersinia pestis [TaxId:632] [89214] (6 PDB entries) 
Domain d1p5ub_: 1p5u B: [87810]
Other proteins in same PDB: d1p5ua1, d1p5ua2
Details for d1p5ub_
PDB Entry: 1p5u (more details), 1.99 Å
PDB Description: x-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
PDB Compounds: (B:) F1 capsule antigenSCOPe Domain Sequences for d1p5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5ub_ b.2.3.2 (B:) F1 capsule antigen Caf1 {Yersinia pestis [TaxId: 632]}
adltasttrtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq
SCOPe Domain Coordinates for d1p5ub_:
Click to download the PDB-style file with coordinates for d1p5ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p5ub_:
- d1p5ub_ first appeared in SCOP 1.65
- d1p5ub_ appears in SCOPe 2.03
- d1p5ub_ appears in SCOPe 2.05
- d1p5ub_ appears in the current release, SCOPe 2.08
View in 3D
