![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins) automatically mapped to Pfam PF08803 |
![]() | Protein automated matches [190315] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187130] (1 PDB entry) |
![]() | Domain d1wd6b_: 1wd6 B: [161359] Other proteins in same PDB: d1wd6a_ automated match to d2asya1 |
PDB Entry: 1wd6 (more details), 2.9 Å
SCOPe Domain Sequences for d1wd6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd6b_ d.58.4.12 (B:) automated matches {Escherichia coli [TaxId: 562]} atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks alaylekhtarlknlgveevvakvfdvneplsqinq
Timeline for d1wd6b_: