Lineage for d1wd6b_ (1wd6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949940Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)
    automatically mapped to Pfam PF08803
  6. 2949948Protein automated matches [190315] (1 species)
    not a true protein
  7. 2949949Species Escherichia coli [TaxId:562] [187130] (1 PDB entry)
  8. 2949950Domain d1wd6b_: 1wd6 B: [161359]
    Other proteins in same PDB: d1wd6a_
    automated match to d2asya1

Details for d1wd6b_

PDB Entry: 1wd6 (more details), 2.9 Å

PDB Description: crystal structure of JW1657 from Escherichia coli
PDB Compounds: (B:) Protein ydhR

SCOPe Domain Sequences for d1wd6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd6b_ d.58.4.12 (B:) automated matches {Escherichia coli [TaxId: 562]}
atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
alaylekhtarlknlgveevvakvfdvneplsqinq

SCOPe Domain Coordinates for d1wd6b_:

Click to download the PDB-style file with coordinates for d1wd6b_.
(The format of our PDB-style files is described here.)

Timeline for d1wd6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wd6a_