Lineage for d1wd6a_ (1wd6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949940Family d.58.4.12: Hypothetical protein YdhR [117940] (2 proteins)
    automatically mapped to Pfam PF08803
  6. 2949941Protein Hypothetical protein YdhR [117941] (1 species)
  7. 2949942Species Escherichia coli [TaxId:562] [117942] (3 PDB entries)
    Uniprot P77225
  8. 2949945Domain d1wd6a_: 1wd6 A: [114525]
    Other proteins in same PDB: d1wd6b_
    Structural genomics target

Details for d1wd6a_

PDB Entry: 1wd6 (more details), 2.9 Å

PDB Description: crystal structure of JW1657 from Escherichia coli
PDB Compounds: (A:) Protein ydhR

SCOPe Domain Sequences for d1wd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd6a_ d.58.4.12 (A:) Hypothetical protein YdhR {Escherichia coli [TaxId: 562]}
atllqlhfafngpfgdamaeqlkplaesinqepgflwkvwteseknheaggiylftdeks
alaylekhtarlknlgveevvakvfdvneplsqinqa

SCOPe Domain Coordinates for d1wd6a_:

Click to download the PDB-style file with coordinates for d1wd6a_.
(The format of our PDB-style files is described here.)

Timeline for d1wd6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wd6b_