SCOP 1.67: Domain d1e2xa1: 1e2x A:6-78

Lineage for d1e2xa1 (1e2x A:6-78)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.6: GntR-like transcriptional regulators [46804] (1 protein)

6. Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)

7. Species Escherichia coli [TaxId:562] [46806] (5 PDB entries)

8. Domain d1e2xa1: 1e2x A:6-78 [16113]
   Other proteins in same PDB: d1e2xa2
   CASP4
   complexed with so4

Details for d1e2xa1

PDB Entry: 1e2x, 2 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli

SCOP Domain Sequences for d1e2xa1:

Sequence; same for both SEQRES and ATOM records:

>d1e2xa1 a.4.5.6 (A:6-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli}
qspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqh
gkptkvnnfwets

Timeline for d1e2xa1:

• d1e2xa1 first appeared (with stable ids) in SCOP 1.55
  
• d1e2xa1 appears in SCOP 1.65
  
• d1e2xa1 appears in SCOP 1.69
  
• d1e2xa1 appears in the current release, SCOPe 2.08