Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) contains a small beta-sheet (wing) |
Family a.4.5.6: GntR-like transcriptional regulators [46804] (1 protein) |
Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species) |
Species Escherichia coli [TaxId:562] [46806] (5 PDB entries) |
Domain d1e2xa1: 1e2x A:6-78 [16113] Other proteins in same PDB: d1e2xa2 CASP4 complexed with so4 |
PDB Entry: 1e2x (more details), 2 Å
SCOP Domain Sequences for d1e2xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2xa1 a.4.5.6 (A:6-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli} qspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiqh gkptkvnnfwets
Timeline for d1e2xa1: