Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) automatically mapped to Pfam PF01035 |
Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins) |
Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species) |
Species Pyrococcus kodakaraensis [TaxId:311400] [46773] (1 PDB entry) |
Domain d1mgta1: 1mgt A:89-169 [16078] Other proteins in same PDB: d1mgta2 complexed with so4 |
PDB Entry: 1mgt (more details), 1.8 Å
SCOPe Domain Sequences for d1mgta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mgta1 a.4.2.1 (A:89-169) O6-alkylguanine-DNA alkyltransferase {Pyrococcus kodakaraensis [TaxId: 311400]} vtpfekkvyewltknvkrgsvitygdlakalntspravggamkrnpypivvpchrvvahd gigyyssgieekkflleiegv
Timeline for d1mgta1: