Lineage for d1mgta1 (1mgt A:89-169)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692898Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (2 families) (S)
    automatically mapped to Pfam PF01035
  5. 2692899Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins)
  6. 2692903Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species)
  7. 2692915Species Pyrococcus kodakaraensis [TaxId:311400] [46773] (1 PDB entry)
  8. 2692916Domain d1mgta1: 1mgt A:89-169 [16078]
    Other proteins in same PDB: d1mgta2
    complexed with so4

Details for d1mgta1

PDB Entry: 1mgt (more details), 1.8 Å

PDB Description: crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
PDB Compounds: (A:) protein (o6-methylguanine-DNA methyltransferase)

SCOPe Domain Sequences for d1mgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mgta1 a.4.2.1 (A:89-169) O6-alkylguanine-DNA alkyltransferase {Pyrococcus kodakaraensis [TaxId: 311400]}
vtpfekkvyewltknvkrgsvitygdlakalntspravggamkrnpypivvpchrvvahd
gigyyssgieekkflleiegv

SCOPe Domain Coordinates for d1mgta1:

Click to download the PDB-style file with coordinates for d1mgta1.
(The format of our PDB-style files is described here.)

Timeline for d1mgta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mgta2