Lineage for d1mgta1 (1mgt A:89-169)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family) 
Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins) Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species) 
Species Pyrococcus kodakaraensis [TaxId:311400] [46773] (1 PDB entry) 
Domain d1mgta1: 1mgt A:89-169 [16078]
Other proteins in same PDB: d1mgta2
Details for d1mgta1
PDB Entry: 1mgt (more details), 1.8 Å
PDB Description: crystal structure of o6-methylguanine-dna methyltransferase from hyperthermophilic archaeon pyrococcus kodakaraensis strain kod1
SCOP Domain Sequences for d1mgta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mgta1 a.4.2.1 (A:89-169) O6-alkylguanine-DNA alkyltransferase {Pyrococcus kodakaraensis}
vtpfekkvyewltknvkrgsvitygdlakalntspravggamkrnpypivvpchrvvahd
gigyyssgieekkflleiegv
SCOP Domain Coordinates for d1mgta1:
Click to download the PDB-style file with coordinates for d1mgta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mgta1:
- d1mgta1 appears in SCOP 1.57
- d1mgta1 appears in the current release, SCOPe 2.08
View in 3D
