SCOPe 2.08: Domain d1bl0a1: 1bl0 A:9-62

Lineage for d1bl0a1 (1bl0 A:9-62)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.8: AraC type transcriptional activator [46759] (2 proteins)
   duplication: consists of two structural repeats bipartite HTH protein

6. Protein MarA [46760] (1 species)

7. Species Escherichia coli [TaxId:562] [46761] (1 PDB entry)

8. Domain d1bl0a1: 1bl0 A:9-62 [16053]
   CASP3
   protein/DNA complex

Details for d1bl0a1

PDB Entry: 1bl0, 2.3 Å

PDB Description: multiple antibiotic resistance protein (mara)/dna complex

PDB Compounds: (A:) protein (multiple antibiotic resistance protein)

SCOPe Domain Sequences for d1bl0a1:

Sequence; same for both SEQRES and ATOM records:

>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]}
daitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyirs

Timeline for d1bl0a1:

• d1bl0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bl0a1 appears in SCOPe 2.07