Lineage for d1fjlb_ (1fjl B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 94902Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 94969Protein Paired protein [46726] (1 species)
  7. 94970Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46727] (1 PDB entry)
  8. 94972Domain d1fjlb_: 1fjl B: [16018]

Details for d1fjlb_

PDB Entry: 1fjl (more details), 2 Å

PDB Description: homeodomain from the drosophila paired protein bound to a dna oligonucleotide

SCOP Domain Sequences for d1fjlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjlb_ a.4.1.1 (B:) Paired protein {Fruit fly (Drosophila melanogaster)}
qrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrk

SCOP Domain Coordinates for d1fjlb_:

Click to download the PDB-style file with coordinates for d1fjlb_.
(The format of our PDB-style files is described here.)

Timeline for d1fjlb_: