SCOP 1.57: Domain d1fjlb_: 1fjl B:

Lineage for d1fjlb_ (1fjl B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.1: Homeodomain [46690] (20 proteins)

6. Protein Paired protein [46726] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46727] (1 PDB entry)

8. Domain d1fjlb_: 1fjl B: [16018]

Details for d1fjlb_

PDB Entry: 1fjl, 2 Å

PDB Description: homeodomain from the drosophila paired protein bound to a dna oligonucleotide

SCOP Domain Sequences for d1fjlb_:

Sequence; same for both SEQRES and ATOM records:

>d1fjlb_ a.4.1.1 (B:) Paired protein {Fruit fly (Drosophila melanogaster)}
qrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrk

Timeline for d1fjlb_:

• d1fjlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjlb_ appears in SCOP 1.59
  
• d1fjlb_ appears in the current release, SCOPe 2.08