Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Paired protein [46726] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46727] (1 PDB entry) |
Domain d1fjlb_: 1fjl B: [16018] protein/DNA complex |
PDB Entry: 1fjl (more details), 2 Å
SCOPe Domain Sequences for d1fjlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjlb_ a.4.1.1 (B:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrk
Timeline for d1fjlb_: