![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (28 proteins) Pfam 00046 |
![]() | Protein Paired protein [46726] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46727] (1 PDB entry) |
![]() | Domain d1fjla_: 1fjl A: [16017] |
PDB Entry: 1fjl (more details), 2 Å
SCOP Domain Sequences for d1fjla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster)} kqrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrkq htsvs
Timeline for d1fjla_: