Lineage for d1fjla_ (1fjl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691924Protein Paired protein [46726] (1 species)
  7. 2691925Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46727] (1 PDB entry)
  8. 2691926Domain d1fjla_: 1fjl A: [16017]
    protein/DNA complex

Details for d1fjla_

PDB Entry: 1fjl (more details), 2 Å

PDB Description: homeodomain from the drosophila paired protein bound to a dna oligonucleotide
PDB Compounds: (A:) paired protein

SCOPe Domain Sequences for d1fjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kqrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrkq
htsvs

SCOPe Domain Coordinates for d1fjla_:

Click to download the PDB-style file with coordinates for d1fjla_.
(The format of our PDB-style files is described here.)

Timeline for d1fjla_: