Lineage for d1fjla_ (1fjl A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1225Family a.4.1.1: Homeodomain [46690] (18 proteins)
  6. 1282Protein Paired protein [46726] (1 species)
  7. 1283Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46727] (1 PDB entry)
  8. 1284Domain d1fjla_: 1fjl A: [16017]

Details for d1fjla_

PDB Entry: 1fjl (more details), 2 Å

PDB Description: homeodomain from the drosophila paired protein bound to a dna oligonucleotide

SCOP Domain Sequences for d1fjla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster)}
kqrrsrttfsasqldelerafertqypdiytreelaqrtnlteariqvwfqnrrarlrkq
htsvs

SCOP Domain Coordinates for d1fjla_:

Click to download the PDB-style file with coordinates for d1fjla_.
(The format of our PDB-style files is described here.)

Timeline for d1fjla_: