Lineage for d1aplc_ (1apl C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 149793Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 149794Family a.4.1.1: Homeodomain [46690] (20 proteins)
  6. 149830Protein mat alpha2 Homeodomain [46695] (1 species)
  7. 149831Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (5 PDB entries)
  8. 149837Domain d1aplc_: 1apl C: [15987]

Details for d1aplc_

PDB Entry: 1apl (more details), 2.7 Å

PDB Description: crystal structure of a mat-alpha2 homeodomain-operator complex suggests a general model for homeodomain-dna interactions

SCOP Domain Sequences for d1aplc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aplc_ a.4.1.1 (C:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae)}
yrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt

SCOP Domain Coordinates for d1aplc_:

Click to download the PDB-style file with coordinates for d1aplc_.
(The format of our PDB-style files is described here.)

Timeline for d1aplc_:

149837
d1aplc_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1apld_