![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein mat alpha2 Homeodomain [46695] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries) |
![]() | Domain d1aplc_: 1apl C: [15987] protein/DNA complex |
PDB Entry: 1apl (more details), 2.7 Å
SCOPe Domain Sequences for d1aplc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aplc_ a.4.1.1 (C:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} yrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
Timeline for d1aplc_: