PDB entry 1apl

View 1apl on RCSB PDB site
Description: crystal structure of a mat-alpha2 homeodomain-operator complex suggests a general model for homeodomain-dna interactions
Deposited on 1993-10-04, released 1993-10-21
The last revision prior to the SCOP 1.61 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.61: d1aplc_
  • Chain 'D':
    Domains in SCOP 1.61: d1apld_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aplC (C:)
    yrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aplD (D:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt