Lineage for d1dw2a_ (1dw2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691303Protein SHP, an oxygen binding cytochrome c [46667] (1 species)
  7. 2691304Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)
  8. 2691311Domain d1dw2a_: 1dw2 A: [15920]
    complexed with hem, no

Details for d1dw2a_

PDB Entry: 1dw2 (more details), 2.2 Å

PDB Description: structure of the nitric oxide complex of reduced shp, an oxygen binding cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1dw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw2a_ a.3.1.1 (A:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides [TaxId: 1063]}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

SCOPe Domain Coordinates for d1dw2a_:

Click to download the PDB-style file with coordinates for d1dw2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dw2a_: