PDB entry 1dw2

View 1dw2 on RCSB PDB site
Description: structure of the nitric oxide complex of reduced shp, an oxygen binding cytochrome c
Class: oxygen storage/transport
Keywords: cytochrome c, nitric oxide, disulfide bridge, asparagine ligation, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2000-01-24, released 2000-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.167
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dw2a_
  • Chain 'B':
    Compound: cytochrome c
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dw2b_
  • Chain 'C':
    Compound: cytochrome c
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dw2c_
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw2A (A:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw2B (B:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw2C (C:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq