Lineage for d2pac__ (2pac -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1015Protein Cytochrome c551 [46660] (4 species)
  7. 1020Species Pseudomonas aeruginosa [TaxId:287] [46662] (4 PDB entries)
  8. 1024Domain d2pac__: 2pac - [15907]

Details for d2pac__

PDB Entry: 2pac (more details)

PDB Description: solution structure of fe(ii) cytochrome c551 from pseudomonas aeruginosa as determined by two-dimensional 1h nmr

SCOP Domain Sequences for d2pac__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pac__ a.3.1.1 (-) Cytochrome c551 {Pseudomonas aeruginosa}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

SCOP Domain Coordinates for d2pac__:

Click to download the PDB-style file with coordinates for d2pac__.
(The format of our PDB-style files is described here.)

Timeline for d2pac__: