![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein Acyl carrier protein [47338] (6 species) |
![]() | Species Escherichia coli [TaxId:562] [47339] (10 PDB entries) Uniprot P02901 |
![]() | Domain d3ejbe1: 3ejb E:21-95 [158170] Other proteins in same PDB: d3ejbb_, d3ejbd_, d3ejbf_, d3ejbh_ automatically matched to d1acpa_ complexed with cl, hem, htg, zmp |
PDB Entry: 3ejb (more details), 2 Å
SCOPe Domain Sequences for d3ejbe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejbe1 a.28.1.1 (E:21-95) Acyl carrier protein {Escherichia coli [TaxId: 562]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyingh
Timeline for d3ejbe1: