Lineage for d3ejbg1 (3ejb G:21-93)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086307Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1086308Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1086309Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1086314Protein Acyl carrier protein [47338] (6 species)
  7. 1086320Species Escherichia coli [TaxId:562] [47339] (10 PDB entries)
    Uniprot P02901
  8. 1086331Domain d3ejbg1: 3ejb G:21-93 [158171]
    Other proteins in same PDB: d3ejbb_, d3ejbd_, d3ejbf_, d3ejbh_
    automatically matched to d1acpa_
    complexed with cl, hem, htg, zmp

Details for d3ejbg1

PDB Entry: 3ejb (more details), 2 Å

PDB Description: crystal structure of p450bioi in complex with tetradecanoic acid ligated acyl carrier protein
PDB Compounds: (G:) Acyl carrier protein

SCOPe Domain Sequences for d3ejbg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejbg1 a.28.1.1 (G:21-93) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyin

SCOPe Domain Coordinates for d3ejbg1:

Click to download the PDB-style file with coordinates for d3ejbg1.
(The format of our PDB-style files is described here.)

Timeline for d3ejbg1: