Class a: All alpha proteins [46456] (284 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein Acyl carrier protein [47338] (6 species) |
Species Escherichia coli [TaxId:562] [47339] (10 PDB entries) Uniprot P02901 |
Domain d3ejbc1: 3ejb C:21-93 [158169] Other proteins in same PDB: d3ejbb_, d3ejbd_, d3ejbf_, d3ejbh_ automatically matched to d1acpa_ complexed with cl, hem, htg, zmp |
PDB Entry: 3ejb (more details), 2 Å
SCOPe Domain Sequences for d3ejbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ejbc1 a.28.1.1 (C:21-93) Acyl carrier protein {Escherichia coli [TaxId: 562]} stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyin
Timeline for d3ejbc1: