| Class b: All beta proteins [48724] (180 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
| Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
| Protein automated matches [191182] (20 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226031] (5 PDB entries) |
| Domain d3ehwc_: 3ehw C: [158156] automated match to d4apza_ complexed with dup, mg |
PDB Entry: 3ehw (more details), 1.8 Å
SCOPe Domain Sequences for d3ehwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ehwc_ b.85.4.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrvap
rsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeiee
vqalddtergsggfgstgkn
Timeline for d3ehwc_: