SCOP 1.75: Domain d3ehwc1: 3ehw C:25-159

Lineage for d3ehwc1 (3ehw C:25-159)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (4 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102010] (4 PDB entries)

8. Domain d3ehwc1: 3ehw C:25-159 [158156]
   automatically matched to d1q5hc_
   complexed with dup, mg

Details for d3ehwc1

PDB Entry: 3ehw, 1.8 Å

PDB Description: Human dUTPase in complex with alpha,beta-imido-dUTP and Mg2+: visualization of the full-length C-termini in all monomers and suggestion for an additional metal ion binding site

PDB Compounds: (C:) dUTP pyrophosphatase

SCOP Domain Sequences for d3ehwc1:

Sequence; same for both SEQRES and ATOM records:

>d3ehwc1 b.85.4.1 (C:25-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]}
qlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrvap
rsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeiee
vqalddtergsggfg

Timeline for d3ehwc1:

• d3ehwc1 is new in SCOP 1.75
  
• d3ehwc1 appears in SCOPe 2.01
  
• d3ehwc1 appears in the current release, SCOPe 2.08, called d3ehwc_