Lineage for d3efxh_ (3efx H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540741Protein automated matches [190381] (4 species)
    not a true protein
  7. 1540824Species Vibrio cholerae [TaxId:37965] [187230] (1 PDB entry)
  8. 1540828Domain d3efxh_: 3efx H: [158138]
    Other proteins in same PDB: d3efxd1
    automated match to d1eeid_

Details for d3efxh_

PDB Entry: 3efx (more details), 1.94 Å

PDB Description: novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
PDB Compounds: (H:) Cholera enterotoxin subunit B, Heat-labile enterotoxin B chain

SCOPe Domain Sequences for d3efxh_:

Sequence, based on SEQRES records: (download)

>d3efxh_ b.40.2.1 (H:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

Sequence, based on observed residues (ATOM records): (download)

>d3efxh_ b.40.2.1 (H:) automated matches {Vibrio cholerae [TaxId: 37965]}
apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpghidsqk
kaiermkdtlriaylteakveklcvwnnktpnsiaaisma

SCOPe Domain Coordinates for d3efxh_:

Click to download the PDB-style file with coordinates for d3efxh_.
(The format of our PDB-style files is described here.)

Timeline for d3efxh_: