Lineage for d3efxd1 (3efx D:1-102)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540283Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1540284Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1540350Domain d3efxd1: 3efx D:1-102 [158134]
    Other proteins in same PDB: d3efxe_, d3efxf_, d3efxg_, d3efxh_, d3efxi_, d3efxj_, d3efxk_, d3efxl_, d3efxm_
    engineered hybrid with E. coli Heat-labile toxin

Details for d3efxd1

PDB Entry: 3efx (more details), 1.94 Å

PDB Description: novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
PDB Compounds: (D:) Cholera enterotoxin subunit B, Heat-labile enterotoxin B chain

SCOPe Domain Sequences for d3efxd1:

Sequence, based on SEQRES records: (download)

>d3efxd1 b.40.2.1 (D:1-102) Cholera toxin {Vibrio cholerae [TaxId: 666]}
apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktpnsiaaisma

Sequence, based on observed residues (ATOM records): (download)

>d3efxd1 b.40.2.1 (D:1-102) Cholera toxin {Vibrio cholerae [TaxId: 666]}
apqnitelcseyhntqiytindkilsyteslagkremaiitfkngatfqvevpgqkkaie
rmkdtlriaylteakveklcvwnnktpnsiaaisma

SCOPe Domain Coordinates for d3efxd1:

Click to download the PDB-style file with coordinates for d3efxd1.
(The format of our PDB-style files is described here.)

Timeline for d3efxd1: