Lineage for d3ee2a1 (3ee2 A:76-199)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1735627Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1736098Protein Class sigma GST [81351] (5 species)
  7. 1736111Species Human (Homo sapiens) [TaxId:9606] [89061] (7 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 1736136Domain d3ee2a1: 3ee2 A:76-199 [158117]
    Other proteins in same PDB: d3ee2a2, d3ee2b2
    automated match to d1pd211
    complexed with gsh, mg, nzo

Details for d3ee2a1

PDB Entry: 3ee2 (more details), 1.91 Å

PDB Description: structure of human prostaglandin d-synthase (hgsts1-1) in complex with nocodazole
PDB Compounds: (A:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d3ee2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ee2a1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipaianwikrrp
qtkl

SCOPe Domain Coordinates for d3ee2a1:

Click to download the PDB-style file with coordinates for d3ee2a1.
(The format of our PDB-style files is described here.)

Timeline for d3ee2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ee2a2