| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class sigma GST [81351] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89061] (16 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase |
| Domain d3ee2a1: 3ee2 A:76-199 [158117] Other proteins in same PDB: d3ee2a2, d3ee2b2 automated match to d1pd211 complexed with gsh, mg, nzo |
PDB Entry: 3ee2 (more details), 1.91 Å
SCOPe Domain Sequences for d3ee2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ee2a1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipaianwikrrp
qtkl
Timeline for d3ee2a1: