Lineage for d1a2s__ (1a2s -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350824Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 350825Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 350826Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 350933Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 350966Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)
  8. 350969Domain d1a2s__: 1a2s - [15800]
    complexed with hec

Details for d1a2s__

PDB Entry: 1a2s (more details)

PDB Description: the solution nmr structure of oxidized cytochrome c6 from the green alga monoraphidium braunii, minimized average structure

SCOP Domain Sequences for d1a2s__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2s__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

SCOP Domain Coordinates for d1a2s__:

Click to download the PDB-style file with coordinates for d1a2s__.
(The format of our PDB-style files is described here.)

Timeline for d1a2s__: