Lineage for d1a2s__ (1a2s -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (7 species) 
Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries) 
Domain d1a2s__: 1a2s - [15800]
Details for d1a2s__
PDB Entry: 1a2s (more details)
PDB Description: the solution nmr structure of oxidized cytochrome c6 from the green alga monoraphidium braunii, minimized average structure
SCOP Domain Sequences for d1a2s__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2s__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw
SCOP Domain Coordinates for d1a2s__:
Click to download the PDB-style file with coordinates for d1a2s__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a2s__:
- d1a2s__ appears in SCOP 1.57
- d1a2s__ appears in the current release, SCOPe 2.08, called d1a2sa_
View in 3D