SCOP 1.69: Domain d1a2s__: 1a2s -

Lineage for d1a2s__ (1a2s -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)

7. Species Monoraphidium braunii [TaxId:34112] [46630] (3 PDB entries)

8. Domain d1a2s__: 1a2s - [15800]

Details for d1a2s__

PDB Entry: 1a2s

PDB Description: the solution nmr structure of oxidized cytochrome c6 from the green alga monoraphidium braunii, minimized average structure

SCOP Domain Sequences for d1a2s__:

Sequence; same for both SEQRES and ATOM records:

>d1a2s__ a.3.1.1 (-) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii}
eadlalgkavfdgncaachagggnnvipdhtlqkaaieqfldggfnieaivyqiengkga
mpawdgrldedeiagvaayvydqaagnkw

Timeline for d1a2s__:

• d1a2s__ first appeared (with stable ids) in SCOP 1.55
  
• d1a2s__ appears in SCOP 1.67
  
• d1a2s__ appears in SCOP 1.71
  
• d1a2s__ appears in the current release, SCOPe 2.08, called d1a2sa_