SCOPe 2.08: Domain d3dyla2: 3dyl A:182-505

Lineage for d3dyla2 (3dyl A:182-505)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
   Uniprot O76083 241-566

8. Domain d3dyla2: 3dyl A:182-505 [157940]
   Other proteins in same PDB: d3dyla3, d3dylb3
   automated match to d2hd1a1
   complexed with fmt, ibm, mg, mn, pcg

Details for d3dyla2

PDB Entry: 3dyl, 2.7 Å

PDB Description: human phosphdiesterase 9 substrate complex (ES complex)

PDB Compounds: (A:) human phosphodiesterase 9

SCOPe Domain Sequences for d3dyla2:

Sequence; same for both SEQRES and ATOM records:

>d3dyla2 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

Timeline for d3dyla2:

• d3dyla2 first appeared in SCOP 1.75, called d3dyla1
  
• d3dyla2 appears in SCOPe 2.07