Lineage for d3dyla1 (3dyl A:182-505)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780284Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 780424Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (1 species)
  7. 780425Species Human (Homo sapiens) [TaxId:9606] [109943] (7 PDB entries)
    Uniprot O76083 241-566
  8. 780436Domain d3dyla1: 3dyl A:182-505 [157940]
    automatically matched to d2hd1a1
    complexed with fmt, ibm, mg, mn, pcg

Details for d3dyla1

PDB Entry: 3dyl (more details), 2.7 Å

PDB Description: human phosphdiesterase 9 substrate complex (ES complex)
PDB Compounds: (A:) human phosphodiestrase 9

SCOP Domain Sequences for d3dyla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dyla1 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

SCOP Domain Coordinates for d3dyla1:

Click to download the PDB-style file with coordinates for d3dyla1.
(The format of our PDB-style files is described here.)

Timeline for d3dyla1: