Lineage for d3df4c1 (3df4 C:125-269)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054645Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2054808Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 2054809Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 2054819Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 2054828Domain d3df4c1: 3df4 C:125-269 [157682]
    Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d3df4c1

PDB Entry: 3df4 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d3df4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df4c1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOPe Domain Coordinates for d3df4c1:

Click to download the PDB-style file with coordinates for d3df4c1.
(The format of our PDB-style files is described here.)

Timeline for d3df4c1: