SCOPe 2.06: Domain d3df4g2: 3df4 G:82-176

Lineage for d3df4g2 (3df4 G:82-176)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d3df4g2: 3df4 G:82-176 [157688]
   Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d3df4g2

PDB Entry: 3df4, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3df4g2:

Sequence; same for both SEQRES and ATOM records:

>d3df4g2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

Timeline for d3df4g2:

• d3df4g2 first appeared in SCOP 1.75
  
• d3df4g2 appears in SCOPe 2.05
  
• d3df4g2 appears in SCOPe 2.07
  
• d3df4g2 appears in the current release, SCOPe 2.08