SCOPe 2.08: Domain d3detd1: 3det D:1-106

Lineage for d3detd1 (3det D:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d3detd1: 3det D:1-106 [157596]
   Other proteins in same PDB: d3deta_, d3detb_, d3detc_, d3detd2, d3dete_, d3detf2
   automated match to d1otsd1
   mutant

Details for d3detd1

PDB Entry: 3det, 2.8 Å

PDB Description: structure of the e148a, y445a doubly ungated mutant of e.coli clc_ec1, cl-/h+ antiporter

PDB Compounds: (D:) Fab fragment, light chain

SCOPe Domain Sequences for d3detd1:

Sequence; same for both SEQRES and ATOM records:

>d3detd1 b.1.1.1 (D:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d3detd1:

• d3detd1 first appeared in SCOP 1.75
  
• d3detd1 appears in SCOPe 2.07