Lineage for d3dete_ (3det E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745275Domain d3dete_: 3det E: [408321]
    Other proteins in same PDB: d3deta_, d3detb_, d3detd1, d3detd2, d3detf1, d3detf2
    automated match to d6shgh_
    mutant

Details for d3dete_

PDB Entry: 3det (more details), 2.8 Å

PDB Description: structure of the e148a, y445a doubly ungated mutant of e.coli clc_ec1, cl-/h+ antiporter
PDB Compounds: (E:) Fab fragment, heavy chain

SCOPe Domain Sequences for d3dete_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dete_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

SCOPe Domain Coordinates for d3dete_:

Click to download the PDB-style file with coordinates for d3dete_.
(The format of our PDB-style files is described here.)

Timeline for d3dete_:

  • d3dete_ is new in SCOPe 2.08-stable