PDB entry 3det

View 3det on RCSB PDB site
Description: Structure of the E148A, Y445A doubly ungated mutant of E.coli CLC_Ec1, Cl-/H+ antiporter
Class: membrane protein
Keywords: CLC_Ec1, antiporter, exchange-transporter, doubly ungated mutant, Chloride, Inner membrane, Ion transport, Membrane, Stress response, Transmembrane, MEMBRANE PROTEIN
Deposited on 2008-06-10, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.257
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: clcA, eriC, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (147)
      • engineered (444)
    Domains in SCOPe 2.07: d3deta_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: clcA, eriC, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (147)
      • engineered (444)
    Domains in SCOPe 2.07: d3detb_
  • Chain 'C':
    Compound: Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DET (0-220)
  • Chain 'D':
    Compound: Fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DET (0-210)
    Domains in SCOPe 2.07: d3detd1, d3detd2
  • Chain 'E':
    Compound: Fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DET (0-220)
  • Chain 'F':
    Compound: Fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3DET (0-210)
    Domains in SCOPe 2.07: d3detf1, d3detf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3detA (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplasailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3detA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplasailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3detB (B:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplasailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >3detB (B:)
    rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
    lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
    tlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
    lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
    lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
    nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
    lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
    ftggkplasailartlakqea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3detD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3detF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra