SCOPe 2.08: Domain d3d5dv1: 3d5d V:1-101

Lineage for d3d5dv1 (3d5d V:1-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.155: L21p-like [141090] (1 superfamily)
   core: sandwich, 6 strands in 2 sheets

4. Superfamily b.155.1: L21p-like [141091] (1 family)
   automatically mapped to Pfam PF00829

5. Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
   Pfam PF00829

6. Protein Ribosomal protein L21p [141093] (3 species)

7. Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries)
   Uniprot P60492 1-101

8. Domain d3d5dv1: 3d5d V:1-101 [157394]
   Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dh1, d3d5dh2, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dy1, d3d5dz1
   complexed with mg
   complexed with mg

Details for d3d5dv1

PDB Entry: 3d5d, 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.

PDB Compounds: (V:) 50S ribosomal protein L21

SCOPe Domain Sequences for d3d5dv1:

Sequence; same for both SEQRES and ATOM records:

>d3d5dv1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

Timeline for d3d5dv1:

• d3d5dv1 first appeared in SCOP 1.75
  
• d3d5dv1 appears in SCOPe 2.07