Lineage for d3d5dh2 (3d5d H:83-170)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541179Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2541180Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2541181Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2541182Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2541337Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 2541345Domain d3d5dh2: 3d5d H:83-170 [157389]
    Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
    complexed with mg
    complexed with mg

Details for d3d5dh2

PDB Entry: 3d5d (more details), 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3d5dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d5dh2 d.141.1.1 (H:83-170) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvr

SCOPe Domain Coordinates for d3d5dh2:

Click to download the PDB-style file with coordinates for d3d5dh2.
(The format of our PDB-style files is described here.)

Timeline for d3d5dh2: