SCOPe 2.08: Domain d3d5dh2: 3d5d H:83-170

Lineage for d3d5dh2 (3d5d H:83-170)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
   Uniprot Q72I19 11-81! Uniprot Q72I19 82-170

8. Domain d3d5dh2: 3d5d H:83-170 [157389]
   Other proteins in same PDB: d3d5d61, d3d5d71, d3d5de1, d3d5dn1, d3d5do1, d3d5dp1, d3d5du1, d3d5dv1, d3d5dy1, d3d5dz1
   complexed with mg
   complexed with mg

Details for d3d5dh2

PDB Entry: 3d5d, 3.21 Å

PDB Description: Structural basis for translation termination on the 70S ribosome. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes as described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3d5dh2:

Sequence; same for both SEQRES and ATOM records:

>d3d5dh2 d.141.1.1 (H:83-170) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvr

Timeline for d3d5dh2:

• d3d5dh2 first appeared in SCOP 1.75
  
• d3d5dh2 appears in SCOPe 2.07